CDS

Accession Number TCMCG057C26269
gbkey CDS
Protein Id XP_018486629.1
Location complement(27761307..27761618)
Gene LOC108857178
GeneID 108857178
Organism Raphanus sativus

Protein

Length 103aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA344915
db_source XM_018631127.1
Definition PREDICTED: histone H4 [Raphanus sativus]

EGGNOG-MAPPER Annotation

COG_category B
Description Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko03036        [VIEW IN KEGG]
KEGG_ko ko:K11254        [VIEW IN KEGG]
EC -
KEGG_Pathway ko05034        [VIEW IN KEGG]
ko05203        [VIEW IN KEGG]
ko05322        [VIEW IN KEGG]
map05034        [VIEW IN KEGG]
map05203        [VIEW IN KEGG]
map05322        [VIEW IN KEGG]
GOs GO:0000228        [VIEW IN EMBL-EBI]
GO:0000785        [VIEW IN EMBL-EBI]
GO:0000786        [VIEW IN EMBL-EBI]
GO:0000788        [VIEW IN EMBL-EBI]
GO:0000790        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003676        [VIEW IN EMBL-EBI]
GO:0003677        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005515        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005634        [VIEW IN EMBL-EBI]
GO:0005694        [VIEW IN EMBL-EBI]
GO:0006323        [VIEW IN EMBL-EBI]
GO:0006325        [VIEW IN EMBL-EBI]
GO:0006333        [VIEW IN EMBL-EBI]
GO:0006334        [VIEW IN EMBL-EBI]
GO:0006996        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0016043        [VIEW IN EMBL-EBI]
GO:0022607        [VIEW IN EMBL-EBI]
GO:0031497        [VIEW IN EMBL-EBI]
GO:0031974        [VIEW IN EMBL-EBI]
GO:0031981        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0032993        [VIEW IN EMBL-EBI]
GO:0034622        [VIEW IN EMBL-EBI]
GO:0034728        [VIEW IN EMBL-EBI]
GO:0042393        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043228        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043232        [VIEW IN EMBL-EBI]
GO:0043233        [VIEW IN EMBL-EBI]
GO:0043933        [VIEW IN EMBL-EBI]
GO:0044085        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044427        [VIEW IN EMBL-EBI]
GO:0044428        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044454        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0044815        [VIEW IN EMBL-EBI]
GO:0051276        [VIEW IN EMBL-EBI]
GO:0065003        [VIEW IN EMBL-EBI]
GO:0065004        [VIEW IN EMBL-EBI]
GO:0070013        [VIEW IN EMBL-EBI]
GO:0071103        [VIEW IN EMBL-EBI]
GO:0071824        [VIEW IN EMBL-EBI]
GO:0071840        [VIEW IN EMBL-EBI]
GO:0097159        [VIEW IN EMBL-EBI]
GO:1901363        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGTCAGGGCGAGGAAAGGGAGGAAAAGGATTAGGAAAGGGAGGAGCCAAGAGGCATCGGAAAGTTCTCCGAGACAACATCCAAGGAATCACCAAACCAGCGATCCGTCGTCTCGCGAGGAGAGGAGGTGTGAAGCGTATCAGCGGATTGATCTACGAAGAGACTCGCGGCGTCCTCAAGATCTTTCTGGAGAACGTGATCCGCGACGCCGTTACTTACACAGAGCACGCTCGCCGGAAAACTGTTACGGCCATGGACGTTGTGTACGCTCTCAAGAGGCAGGGAAGAACTCTGTACGGATTCGGCGGCTGA
Protein:  
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG